PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID DCAR_000809
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; asterids; campanulids; Apiales; Apiineae; Apiaceae; Apioideae; Scandiceae; Daucinae; Daucus
Family WRKY
Protein Properties Length: 158aa    MW: 17814.8 Da    PI: 5.8497
Description WRKY family protein
Gene Model
Gene Model ID Type Source Coding Sequence
DCAR_000809genomeARS-USDAView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1WRKY101.84e-3295153159
                  ---SS-EEEEEEE--TT-SS-EEEEEE-STT---EEEEEE-SSSTTEEEEEEES--SS- CS
         WRKY   1 ldDgynWrKYGqKevkgsefprsYYrCtsagCpvkkkversaedpkvveitYegeHnhe 59 
                  ldDg++WrKYG+K+vk+s++pr+YYrC+ +gC vkk+ver++edp++v++tYeg+Hnh+
  DCAR_000809  95 LDDGFKWRKYGKKMVKNSPMPRNYYRCSIEGCAVKKRVERDREDPRYVITTYEGQHNHQ 153
                  59********************************************************8 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
Gene3DG3DSA:2.20.25.805.5E-3480153IPR003657WRKY domain
SuperFamilySSF1182909.55E-2987153IPR003657WRKY domain
PROSITE profilePS5081130.61890155IPR003657WRKY domain
SMARTSM007745.3E-3695154IPR003657WRKY domain
PfamPF031067.3E-2596153IPR003657WRKY domain
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0009867Biological Processjasmonic acid mediated signaling pathway
GO:0050832Biological Processdefense response to fungus
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 158 aa     Download sequence    Send to blast
MDDTGFRSFE SSRSDNYGSF EFSELLEFDE WAEADPGVMV SGYPVDPVYA AANDGRSIVG  60
GSSNVEASNA RGNIGSRAAR KEKVAFRTMT EIEILDDGFK WRKYGKKMVK NSPMPRNYYR  120
CSIEGCAVKK RVERDREDPR YVITTYEGQH NHQANML*
3D Structure ? help Back to Top
Structure
PDB ID Evalue Query Start Query End Hit Start Hit End Description
1wj2_A2e-2785152774Probable WRKY transcription factor 4
2lex_A2e-2785152774Probable WRKY transcription factor 4
Search in ModeBase
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00531DAPTransfer from AT5G26170Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_015884439.16e-58PREDICTED: probable WRKY transcription factor 50
SwissprotQ8VWQ53e-45WRK50_ARATH; Probable WRKY transcription factor 50
TrEMBLA0A059CLX95e-54A0A059CLX9_EUCGR; Uncharacterized protein
STRINGPOPTR_0006s24050.14e-51(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
AsteridsOGEA21242462
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT5G26170.19e-43WRKY DNA-binding protein 50